PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030185m
Common NameCICLE_v10030185mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 497aa    MW: 54724.1 Da    PI: 6.0154
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030185mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-33265319155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  Ciclev10030185m 265 KPRMRWTPELHECFVEAVNKLDGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 319
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.419262322IPR017930Myb domain
SuperFamilySSF466894.3E-18263319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-32264320IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-26265320IPR006447Myb domain, plants
PfamPF002494.1E-10267318IPR001005SANT/Myb domain
PfamPF143793.0E-21354400IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MNHHSIISVT KNESNKGVSQ SCCSALSPIH NFQTEGQSLS TGEYPFPHPS PFIRKESLSS  60
PNRMQASTVV PKENGLISTL DSPISPGSHF QHSKGGFSRS SVFCTSLYLS SSASSETHRQ  120
IGNFPFLPHP RTFNQSVSAV DSTKSSLLFS EDMGNAYQEE HSESLMKGFL NFPEDASDGS  180
FPGVTCMGER LGLNEHLELQ FLSDELDIDI TDHGENPRLD EIDDAPKSSL EPPMGLSCNE  240
NYVSSAPPVD ALSSHTSPAS ATAHKPRMRW TPELHECFVE AVNKLDGPEK ATPKAVLKLM  300
NVEGLTIYHV KSHLQKYRLA KYMPEKKEEK KTCSSEEKKA TSSIESDGRK KGSIQFTEAL  360
RMQMEVQKQL HEQLEVQRAL QLRIEEHARY LEKIVAEQQK DGSATILPQA QSLSTITNGS  420
KDSEQQPSPP SFTVSAILSP EQPAESKTES SSTSLLSKHK ATDSRESKPD ACLKRIRLEN  480
KPEITSDEAV VENPVQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425193.10.0hypothetical protein CICLE_v10030185mg
TrEMBLV4RUQ00.0V4RUQ0_9R
STRINGPOPTR_0007s15110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-112G2-like family protein